The short version of GW501516 fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-10. Anything still debated is marked as such rather than presented as settled.
Handling and quality assessment of cardarine reference material follow general laboratory practices for poorly characterized compounds. It typically appears as a white to off-white powder and is sparingly soluble in water but soluble in organic solvents such as dimethyl sulfoxide and ethanol. Storage recommendations usually specify a cool, dry, dark place, with long-term storage at low temperature and desiccation. Purity may be checked by high-performance liquid chromatography with ultraviolet detection, while identity is confirmed by mass spectrometry and nuclear magnetic resonance. No pharmacopeial monograph exists, so reported purity and stability depend on the supplier’s methods.
GW501516 acts as a selective agonist at PPARδ, a nuclear receptor that regulates transcription of genes involved in lipid handling and energy metabolism. Activation of PPARδ in preclinical models increases fatty acid oxidation, mitochondrial biogenesis, and exercise endurance in rodents. These effects have made the compound a subject of metabolic research and also a target for sport anti-doping rules. In humans, however, controlled studies are limited, and whether similar endurance or metabolic changes occur at tolerated exposures remains an open question. The receptor’s broad tissue distribution also means downstream effects may vary by organ and condition.
Detection of GW501516 in biological samples generally relies on liquid chromatography coupled with tandem mass spectrometry. Urine is a common matrix in anti-doping analysis, while blood or plasma may be used in research settings. Sample preparation can involve enzymatic hydrolysis, protein precipitation, or solid-phase extraction before instrumental analysis. Because the compound undergoes metabolism, assays may target the parent molecule, one or more metabolites, or both. Detection windows are not fixed; they depend on factors such as dose, route, individual metabolism, and assay sensitivity. Reference standards are required for accurate identification and quantification.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Visual description for typical solid reference material. |
| Solubility | Poorly soluble in water; soluble in DMSO | Solubility depends on solvent, purity, and form. |
| Storage | Cool, dry, protected from light | Long-term storage often uses low temperature and desiccant. |
| Common analytical method | LC-MS/MS | Used for detection and quantification in biological matrices. |
| Common synonyms | GW-501516; GW501516; endurobol | Naming varies among literature, vendors, and databases. |
Published studies have examined GW501516 in animal models of obesity, insulin resistance, and exercise endurance. Early human trials reportedly ended, and development was discontinued after preclinical findings raised concerns about cancer in some rodent studies. Regulatory agencies have not approved cardarine for any medical use. Its availability through non-pharmaceutical channels raises questions about identity, purity, and legal status that are separate from its laboratory pharmacology. Those questions are often addressed through analytical testing rather than assumptions about product labels.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
A bee sting is the wound and pain caused by the stinger of a female bee puncturing skin. Bee stings differ from insect bites, with the venom of stinging insects having considerable chemical variation. The reaction of a person to a bee sting may vary according to the bee species and the person's own immune response. While bee stinger venom is slightly acidic and causes only mild pain in most people, allergic reactions may occur in people with allergies to venom components, which can be life-threatening if not treated immediately.
A ball check valve is a check valve in which the closing member, the movable part to block the flow, is a ball. In some ball check valves, the ball is spring-loaded to help keep it shut. For those designs without a spring, reverse flow is required to move the ball toward the seat and create a seal. The interior surface of the main seats of ball check valves are more or less conically tapered to guide the ball into the seat and form a positive seal when stopping reverse flow. Ball check valves are often very small, simple, and cheap. They are commonly used in liquid or gel minipump dispenser spigots, spray devices, some rubber bulbs for pumping air, etc., manual air pumps and some other pumps, and refillable dispensing syringes. Although the balls are most often made of metal, they can be made of other materials; in some specialized cases out of highly durable or inert materials, such as sapphire. High-performance liquid chromatography pumps and similar high pressure applications commonly use small inlet and outlet ball check valves with balls of (artificial) ruby and seats made of sapphire or both ball and seat of ruby, for both hardness and chemical resistance. After prolonged use, such check valves can eventually wear out or the seat can develop a crack, requiring replacement. Therefore, such valves are made to be replaceable, sometimes placed in a small plastic body tightly fitted inside a metal fitting which can withstand high pressure and which is screwed into the pump head.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
=== No development reported === Adapalene/minocycline (FCD-105) – combination of adapalene (retinoid) and minocycline (tetracycline antibiotic) Auriclosene (AgaDerm; AgaNase; AL-46383A; CD-07223; DCDMT; NVC-422) – aganocide compound and antimicrobial Bermekimab (CA-18C3; CV-18C3; Hutruo; JNJ-77474462; MAB-p1; RA-18C3; T2-18C3; Xilonix) – monoclonal antibody against interleukin-1α BOS-356 (GSK-3008356) – diacylglycerol O-acyltransferase inhibitor Brilacidin (PMX-30063) – host defense protein (HDP) mimetic antibiotic Carbamide peroxide topical (E-0301) – disinfectant and bleaching agent CJM-112 – IL17A and IL17F inhibitor Clindamycin/tretinoin – combination of clindamycin (lincosamide antibiotic) and tretinoin (retinoid) Clindamycin/tretinoin – combination of clindamycin (lincosamide antibiotic) and tretinoin (retinoid) DMT-200 (DMT-210; DMT-220; SIG-990) – isoprenylcysteine analogue and various actions Estradiol valerate/dienogest (Climodien; Climodiène; Klimodien; Lafamme) – combination of estradiol valerate (estrogen) and dienogest (progestogen) Ethinylestradiol/chlormadinone acetate (Balianca; Belara; GRT4248) – combination of ethinylestradiol (estrogen) and chlormadinone acetate (progestogen) and a combined oral contraceptive Ethinylestradiol/drospirenone (Petibelle; SH-470; Yasmin; ZK-30595) – combination of ethinylestradiol (estrogen) and drospirenone (progestogen) GSK-1940029 – stearoyl-CoA desaturase inhibitor GT-20029 (AR-PROTAC) – androgen receptor degradation enhancer IP10-C8 – CD13 antigen inhibitor and dipeptidyl peptidase 4 (DPP4) inhibitor Minocycline extended release (Emrosi; Ximino) – tetracycline antibiotic Minocycline topical (HY01) – tetracycline antibiotic MTC-896 – melanocortin receptor antagonist Nitric oxide (Enovid; FabiSpray; NORS-0791; NORS-1002; NORS-2791; NORS-4002; NORS-6491; NORS) – nitric oxide donor ORG-101 (acne vulgaris vaccine; ORI-001; ORI-A-ce001) – immunostimulant, vaccine Radezolid (RX-01667; Rx-01_667; RX-103; RX-1741) – oxazolidone antibiotic Research programme: antimicrobial therapies - NovaBiotics – cell membrane permeability enhancers Research programme: synthetic cannabinoid therapeutics - Claritas Pharmaceuticals – cannabinoids (cannabinoid receptor modulators) Research programme: therapeutic antibody fragments - Kuur Therapeutics – various actions Silver dihydrogen citrate (SDC; Axenohl) – antiseptic/antibacterial Tazarotene topical (DFD-03) – retinoid X receptor agonist
Sources: en.wikipedia.org
=== Meat === Fermented meats, sausage, jerky, and corned beef can last many months without refrigeration. Pastirma is a beef product that is often eaten raw in the Middle East and Mediterranean countries. It is made from the hindquarter of beef cattle. Pastirma is a type of intermediate moisture food and can be stored for several months in humid climates. The meat is salted and dried to reduce water activity and increase microbial safety. Additionally, nitrites are added for preservation. The final product has 5% salt and a moisture content between 30-35%.
Itching Nausea Sedation Respiratory depression - can be potentially life-threatening However, since viminol is supplied as a racemic mixture of agonist and antagonist isomers, the abuse potential and respiratory depression tends to be less than that of μ-opioid full agonist drugs. Drug dependence may occur.
Hong Kong is a special administrative region of China, with executive, legislative, and judicial powers devolved from the national government. The Sino-British Joint Declaration provided for economic and administrative continuity through the handover, resulting in an executive-led governing system largely inherited from the territory's history as a British colony. Under these terms and the "one country, two systems" principle, the Basic Law of Hong Kong is the regional constitution. The regional government is composed of three branches:
On 15 September 2022, during a speech commemorating El Salvador's 201st anniversary of independence, Bukele announced that he would run for re-election in 2024. According to Bukele, "developed countries have re-election, and thanks to the new configuration of the democratic institution of our country, now El Salvador will too". Constitutional lawyers criticized his announcement, saying that presidential re-election violates "at least" four articles of the El Salvador constitution.
=== People's Party === People's Party leader Natthaphong Ruengpanyawut accepted the preliminary results that indicated the party was unlikely to finish first. After thanking voters, Natthaphong remarked how the constitutional referendum appeared to be approved by the public. He agreed that the party would respect parliamentary process, and to lead the opposition if Bhumjaithai managed to form a government. Natthaphong reiterated that it would not join a government led by a Bhumjaithai prime minister and that it would not form a rival coalition against a potential Bhumjaithai government.
Sources: en.wikipedia.org
Cardarine targets PPARδ, a nuclear receptor involved in lipid and energy metabolism. It does not bind the androgen receptor in the way SARMs do.
Most methods use liquid chromatography with tandem mass spectrometry. Urine is common in anti-doping testing, and blood or plasma may be used in research.
Typical guidance is cool, dry, dark storage, often at low temperature and with desiccant. Stability data are limited, so storage conditions should be verified for each batch or supplier.
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.