This is a working overview of fatty acid oxidation, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-08-01. Anything still debated is marked as such rather than presented as settled.
Handling and quality assessment of cardarine reference material follow general laboratory practices for poorly characterized compounds. It typically appears as a white to off-white powder and is sparingly soluble in water but soluble in organic solvents such as dimethyl sulfoxide and ethanol. Storage recommendations usually specify a cool, dry, dark place, with long-term storage at low temperature and desiccation. Purity may be checked by high-performance liquid chromatography with ultraviolet detection, while identity is confirmed by mass spectrometry and nuclear magnetic resonance. No pharmacopeial monograph exists, so reported purity and stability depend on the supplier’s methods.
GW501516 acts as a selective agonist at PPARδ, a nuclear receptor that regulates transcription of genes involved in lipid handling and energy metabolism. Activation of PPARδ in preclinical models increases fatty acid oxidation, mitochondrial biogenesis, and exercise endurance in rodents. These effects have made the compound a subject of metabolic research and also a target for sport anti-doping rules. In humans, however, controlled studies are limited, and whether similar endurance or metabolic changes occur at tolerated exposures remains an open question. The receptor’s broad tissue distribution also means downstream effects may vary by organ and condition.
Detection of GW501516 in biological samples generally relies on liquid chromatography coupled with tandem mass spectrometry. Urine is a common matrix in anti-doping analysis, while blood or plasma may be used in research settings. Sample preparation can involve enzymatic hydrolysis, protein precipitation, or solid-phase extraction before instrumental analysis. Because the compound undergoes metabolism, assays may target the parent molecule, one or more metabolites, or both. Detection windows are not fixed; they depend on factors such as dose, route, individual metabolism, and assay sensitivity. Reference standards are required for accurate identification and quantification.
Laboratory handling focuses on identity, purity, and stability. Reference standards are typically stored cold and dry, protected from light, because solutions can degrade over time. Analytical checks may use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Impurities and related substances can be separated chromatographically and compared with a known standard. Because cardarine is not an approved drug, compendial monographs are absent, and laboratories often rely on in-house methods. Reported purity varies among unregulated products and should not be assumed from a label.
GW501516 binds and activates PPARδ, a nuclear receptor that influences transcription of genes involved in fatty acid oxidation and energy use. Activation shifts some metabolic pathways in preclinical models, which is why the compound has been studied for lipid disorders and exercise-related endpoints. The exact downstream effects in humans are incompletely mapped. PPARδ is expressed in many tissues, including skeletal muscle, liver, and adipose tissue, so broad activation may have varied consequences. Researchers continue to examine how selective or partial activation might alter the balance between benefits and risks.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Visual description for typical solid reference material. |
| Solubility | Poorly soluble in water; soluble in DMSO | Solubility depends on solvent, purity, and form. |
| Storage | Cool, dry, protected from light | Long-term storage often uses low temperature and desiccant. |
| Common analytical method | LC-MS/MS | Used for detection and quantification in biological matrices. |
| Common synonyms | GW-501516; GW501516; endurobol | Naming varies among literature, vendors, and databases. |
PPARδ is a nuclear receptor that regulates gene expression related to fatty acid oxidation, glucose homeostasis, and mitochondrial function. GW501516 binds to this receptor with high affinity and activates downstream signaling in skeletal muscle and other tissues. Animal studies reported increased endurance and altered fuel preference, but human data remain limited and inconsistent. The precise relationship between receptor activation and observed physiological changes is still an area of active investigation. Researchers have also examined whether the compound affects inflammation or cell proliferation. No approved therapeutic indication exists for cardarine.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
Anti-doping laboratories identify GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the usual matrix, and detection can occur after the parent compound has cleared from blood. The exact detection window depends on dose, formulation, individual metabolism, and assay sensitivity. Because the compound is prohibited at all times, athletes are subject to testing in and out of competition. Analytical methods continue to improve as new metabolites and designer analogs are characterized.
GW501516 acts as a ligand for PPAR delta, a nuclear receptor that regulates transcription of genes involved in fatty acid oxidation and energy use. Activation of this receptor in skeletal muscle shifts metabolism toward fat burning in animal models. The compound does not burn fat directly; it changes gene expression over hours to days. Researchers study it to understand metabolic flexibility and exercise adaptation. Effects observed in rodents are not automatically expected in humans.
Nanoghosts are nanosized vesicles containing a chosen drug delivery payload manufactured from extracted leukocyte membranes with the cell cytoplasm content removed. The use of biological membranes serves to mask the particles from the immune system to reduce the likelihood of an immunogenic response, as well as to extend circulation of the particles in the blood. They are produced by homogenizing the cells to remove the cytosol, and then sonicating the empty cell membranes to create nanoghosts between 100 and 200 nm in diameter. Membranes used to make nanoghosts harvested form red blood cells have been shown to circulate for about 120 days and avoid phagocytotic cells. Neutrophil based nanoghosts retain the chemotaxis capacity of neutrophils to sites of inflammation, which encourages tumor targeting. NK based nanoghosts exhibit metastatic cancer targeting behavior. Monocyte based nanoghosts are effective at infiltrating the tumor microenvironment. Mesenchymal stem cell derived nanoghosts exhibit cancer targeting properties.
== External links == The LIVEChart of Nuclides – IAEA AlphaDelta: Stable Isotope fractionation calculator Archived 2011-04-02 at the Wayback Machine National Isotope Development Center Reference information on isotopes, and coordination and management of isotope production, availability, and distribution Isotope Development & Production for Research and Applications (IDPRA) U.S. Department of Energy program for isotope production and production research and development Isosciences Archived 2021-01-18 at the Wayback Machine Use and development of stable isotope labels in synthetic and biological molecules
1 by the Minister, after consultation with such bodies representative of those interests as he may think fit, to represent the interests of persons (other than the British Transport Commission and any Executive) who are holders of A or B licences (within the meaning of Part IV of this Act) carrying on business within the London Traffic Area:† 1 by the Minister, after consultation with such bodies representative of those interests as he may think fit, to represent the interests of persons who are holders of C licences (within the meaning of Part IV of this Act) carrying on business within the London Traffic Area:† 1 by the Minister, after consultation with such bodies representative of those interests as he may think fit, to represent the interests of persons (other than the British Transport Commission and any Executive) who are the holders of licences authorising them to operate public service vehicles within the London Traffic Area: 1 by the Minister, after consultation with such bodies representative of those interests as he may think fit, to represent the interests of persons (other than the British Transport Commission and any Executive) providing or using horse-drawn road vehicles within the London Traffic Area. 1 by the Minister, after consultation with such bodies representative of those interests as he may think fit, to represent the interests of the taxi-cab industry within the London Traffic Area.
In May 2023, Peña announced the intention to move the Paraguayan embassy in Israel from Tel Aviv to Jerusalem. That measure had previously been taken by Horacio Cartes in 2018, but reversed by Mario Abdo Benítez later that same year, causing Israel to close its embassy in Asunción. According to Paraguayan foreign minister Rubén Ramírez Lezcano, the Israeli embassy in Paraguay was expected to reopen in July 2024. After the outbreak of the war between Israel and Gaza in October 2023, Peña's government adopted a strongly pro-Israel stance, with Paraguay abstaining or voting against several United Nations resolutions calling for a cessation of hostilities between Israel and Hamas, including a vote recognizing Palestine as a legitimate state, in which Paraguay abstained. Likewise, Paraguay opposed the South African case before the International Court of Justice against Israel, in which the former accused the latter of committing genocide in the Gaza Strip, and also opposed the intention of Karim Khan, chief prosecutor of the International Criminal Court, to issue international arrest warrants against Israeli prime minister Benjamin Netanyahu and his defense minister Yoav Gallant, calling it "incorrect". In public statements, Peña has argued that support for Israel goes beyond his personal view and represents, in his words, "a message from the entire Paraguayan nation", appealing to a historical and political affinity between the two countries.
Connective tissue disorders predispose women to developing cystocele and other pelvic organ prolapses. The tissues tensile strength of the vaginal wall decreases when the structure of the collagen fibers change and become weaker.
Sources: en.wikipedia.org
The many-banded krait (Bungarus multicinctus) is the second most venomous krait species known, based on toxinological studies conducted on mice. The venom of the many-banded krait consists of both pre- and postsynaptic neurotoxins (known as α-bungarotoxins and β-bungarotoxins, among others). Due to poor response to antivenom therapy, mortality rates are very high in cases of envenomation – up to 50% of cases that receive antivenom are still fatal. Case fatality rates of the many-banded krait envenoming reach 77–100% without treatment. The average venom yield from specimens kept on snake farms was between 4.6 and 18.4 mg per bite. In another study, the average venom yield was 11 mg (Sawai, 1976). The venom is possibly the most toxic of any Bungarus (krait) species and possibly the most toxic of any snake species in Asia, with LD50 values of 0.09 mg/kg–0.108 mg/kg SC, 0.113 mg/kg IV and 0.08 mg/kg IP on mice. Based on several LD50 studies, the many-banded krait is among the most venomous land snakes in the world. The Taiwan National Poison Control Center reports that the chief cause of death from snakebite during the decade (2002–2012) was respiratory failure, with 80% of these caused by bites from the many-banded krait.
== British and Commonwealth realms == In Commonwealth realms, including the United Kingdom, Canada, Australia and New Zealand, centenarians can receive congratulatory cards from the monarch, currently King Charles III, on their 100th birthday. In the UK, greeting cards are also sent by the monarch on every birthday beginning with the 105th. In Commonwealth realms in which the monarch does not ordinarily reside, honorees can also receive congratulations from the governor-general. In Canada, application must be made through the GGS official website. Similarly, in New Zealand, honorees must apply for greetings through the official government website.
== References == Gray's Anatomy: The Anatomical Basis of Clinical Practice, Expert Consult, 40e. By Susan Standring, PhD, DSc, Emeritus Professor of Anatomy, Head of Anatomy and Human Sciences, King's College London, London, UK. 9780443066849
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Sources: en.wikipedia.org
Cardarine targets PPARδ, a nuclear receptor involved in lipid and energy metabolism. It does not bind the androgen receptor in the way SARMs do.
Most methods use liquid chromatography with tandem mass spectrometry. Urine is common in anti-doping testing, and blood or plasma may be used in research.
Typical guidance is cool, dry, dark storage, often at low temperature and with desiccant. Stability data are limited, so storage conditions should be verified for each batch or supplier.
Anti-doping and clinical laboratories commonly use liquid chromatography-tandem mass spectrometry. The method can identify GW501516 and its metabolites in urine or blood. Detection depends on sample timing and the amount present.